PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17625A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family TALE
Protein Properties Length: 454aa    MW: 49358.5 Da    PI: 7.1793
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17625AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.6e-093934301954
                                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                Fe+   +yp+ +e+e LA++ gL+ +qV++WF N R +
  Oropetium_20150105_17625A 393 FENflRPYPKDNEKEMLAARSGLSRSQVSNWFINARVR 430
                                6665689*****************************88 PP

2BELL21.75e-08266330569
                       BELL   5 lqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaia 69 
                                ++k ++ Ll+ll+ +d+  +q+ +++q+ +s +  ++  g  ++ + +A +a+S  +r L+ +i+
  Oropetium_20150105_17625A 266 HHKLRNDLLKLLQLMDQLCNQWLDEMQAAASKYGSMVSPGGGALSAPFAHNAVSTMHRRLRARIV 330
                                556678899999999***********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075265.8E-17199329IPR006563POX domain
PROSITE profilePS5007111.645371434IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.4E-25373447IPR009057Homeodomain-like
SuperFamilySSF466891.2E-15374443IPR009057Homeodomain-like
SMARTSM003893.6E-7374438IPR001356Homeobox domain
CDDcd000861.37E-11374435No hitNo description
PfamPF059205.8E-16391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 454 aa     Download sequence    Send to blast
MTGNASCQQF GVDVMMSSSC FVSNMVGADA AMVQVPEYMP HDGGWGFGGF LADDRAVLAG  60
PLQLVRATAP PEEAHGAYNV AGGYGPSPSD VTVALPAKLV GEPERSWTHE QYYSPTWFFS  120
GDGFRDPFTA AARELSLRLA AESSSTGTVV NLPADQSSDV SCSGLTHASS NAGHGLFQPP  180
YFGGGEQGAR PGRPHFSQVL SRSGYAHIVQ QTLDEFVGRV LQDVAGATGT VVGEAANCPL  240
PSSSSSMTTP SSQSVVVFPS AEERPHHKLR NDLLKLLQLM DQLCNQWLDE MQAAASKYGS  300
MVSPGGGALS APFAHNAVST MHRRLRARIV AESQRTWEHS SSASLAERER SWESAFIQKH  360
WALRQLRRAD QQSWRPQRGL PVKSVAVLKA WMFENFLRPY PKDNEKEMLA ARSGLSRSQV  420
SNWFINARVR LWKPMIEEMY EDLKKATAAP LNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0837551e-119BT083755.1 Zea mays full-length cDNA clone ZM_BFb0035M24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008658298.11e-172PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658299.11e-172PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658300.11e-172PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658301.11e-172PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
RefseqXP_008658302.11e-172PREDICTED: putative POX domain/homeobox DNA-binding domain family protein isoform 1 isoform X1
TrEMBLC4IYV81e-172C4IYV8_MAIZE; Putative POX domain/homeobox DNA-binding domain family protein
STRINGGRMZM2G076272_P011e-171(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31433365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.16e-41homeobox gene 1